|
 |
Monday, April 07, 2003 |
MOUStech.INFO April 7, 2003 - International Headlines:
10th SARS victim dies in Ontario The Globe And Mail: National
DR of Congo: UN investigates reports of massacres in troubled Ituri region UN News Service: Peace & Security
U.S. Tests Possible Chem Weapons Find CBS News: Iraq Crisis
U.K.: 'Chemical Ali' Found Dead in Basra AP World News
Annan Seeks Security Council Iraq Meeting AP World News
U.S. Finds Possible Chemical Weapons Site AP World News
Get unwired! Wired magazine's special issue on WiFi. Paul Boutin writes about this month's issue of Wired, to which we each contributed multiple items. Update: BoingBoing's founder Mark Frauenfelder was also a contributor!
The current issue of Wired mag includes a Wi-Fi primer, bundled as a 60-page mini-magazine that pops out to keep or, better yet, pass around. UnWired features articles on understanding the Wi-Fi landscape and setting up your own network. BoingBoing regular Xeni Jardin and I were both so enthusiastic about UnWired that we contributed two articles each.
Xeni explains our use of the radio spectrum as it is, and as it could be. I put aside my usual snobbery about doing how-to articles and business landscapes to hammer out a long getting started primer written with my family in Maine in mind. It lists specific products and services - Linksys, AirPort, Starbucks, Surf and Sip - that I know will work for those who follow the instructions, yet won't bankrupt families that can't rush out to buy a new laptop. Or businesses that can't splurge on T1 infrastructure. I also list "25 Companies to Watch," a cocktail party primer rather than an investment guide. Most of the blog-reading crowd will find much of this familiar material, so here's a suggestion: Buy Wired for Steve Silberman's Matrix story on the cover, but yank out UnWired and give it to someone who hasn't yet cut the Ethernet cord. Remember when you installed Mosaic for someone you loved back in 1994? It's that time all over again. Boing Boing Blog
Bush and Blair in Belfast to Discuss Iraq, U.N. and Europe. Allied advances on the ground in Iraq underlined the urgency of settling trans-Atlantic differences over the conflict's aftermath. By Warren Hoge. New York Times: NYT HomePage
Tim Bray's ongoing conversation with the world. If you haven't yet tuned into Tim Bray's weblog, you're missing a rare treat. For those of us whose bedtime reading does not run to the likes of Herodotus' Histories ("in the Aubrey de Sélincourt translation"), have never photographed an odometer, and do not casually toss off tutorials on binary search and Unicode, it can be a bit intimidating. But it is also a pure delight. "I propose that we define a weblog as a conversation between a person and the world," Tim wrote last month. Speaking for the world, it's going to be a challenge to hold up our end of that conversation! ... Jon's Radio
China Urges U.N. Role in Post-War Iraq. China and Japan want the United Nations to play a role in Iraq's postwar reconstruction, and Tokyo hopes the bitterly divided U.N. Security Council can reach a consensus on the issue, a Japanese official said Monday. Associated Press war headlines via GoUpstate.com
Half of U.S. Troop Deaths Said Accidental. Since the war began in Iraq, one American soldier has been electrocuted, at least two others have drowned and nine more have died in automobile wrecks. All appear to be victims of accidents, which so far are responsible for about half the fatalities among U.S. troops sent to the Middle East for the war. Associated Press war headlines via GoUpstate.com
Police Attack Calif. Anti-War Protesters. Police opened fire with non-lethal projectiles at an anti-war protest at the Port of Oakland on Monday morning, injuring at least six demonstrators and six longshoremen standing nearby. Associated Press war headlines via GoUpstate.com
U.S. Finds Possible Chemical Weapons Site. The U.S. military is testing samples from a site in Iraq where soldiers found metal drums containing possible chemical weapons, defense officials said Monday. Tests at laboratories in the United States have to be completed before the presence of chemical weapons would be known, the officials said. Associated Press war headlines via GoUpstate.com
Librarians Use Shredders to Counter New F.B.I. Powers. "It used to be a librarian would be pictured with a book," said Ms. Snider, the branch manager, slightly exasperated as she hunched over the wastebasket. "Now it is a librarian with a shredder." Librarians in America, specifically those in Santa Cruz, California, have resorted to shredding nearly all documents or records of any sort in order to counter the United States' new Patriot Act (EFF critique), a law passed after 9/11 which significantly broadened the federal authorities' ability to tap into public information in the name of anti-terrorism. Many libraries have begun distributing leaflets to visitors which detail their objections to the increased F.B.I. power and explain that librarians are in the process of reviewing their files to ensure that any and all data they have about borrowing and computer usage histories is absolutely necessary to their operation. kuro5hin.org
Microsoft's Ballmer fights Linux in Munich IDG InfoWorld
Latest SARS evidence GenomeBiology.com
UN chief appoints special adviser on Iraq Xinhua News
PENTAGON SAYS MATERIAL FOUND IN HINDIYAH, IRAQ,TEST POSITIVE FOR CHEMICA Xinhua News
Nihon Gene Research Lab to Use CombiMatrix Biochip Synthesizer for Services Business GenomeWeb
U.N. predicts Iraq war will cost trillions UPI: International
Get unwired! Wired magazine's special issue on WiFi bOing bOing
Iraq: Saddam's House of Horrors Pravda.RU:Main
American Internet Surfers Run Away from American Internet Pravda.RU:Main
ADVISORY/Bioterrorism: Myth and Reality; ASIS International and the National Foundation for Infectious Diseases Examine the Insidious and Growing T... BioWire 2k: Biotech
UN official dies of SARS while on mission in China UN News Service
UN aid agencies paint grim picture of massive relief tasks in Iraq UN News Service
Annan sees important UN role in post-conflict Iraq, names special adviser UN News Service
Red Cross: Iraq Casualties Too High to Count CommonDreams NewsWire
Rubber Bullets Quiet Oakland Protest CBS News: Iraq Crisis
WHO urges drive against preventable diseases killing 5 million children each year UN News Service: Health, Poverty, Food Security
Guarantee the health of every child to achieve sustainable development – Annan UN News Service: Health, Poverty, Food Security
UN fund for fighting hunger launches first project in Caribbean UN News Service: Health, Poverty, Food Security
U.S. finds possible chemical weapons site Chicago Sun-Times
Caroline Hawley, Amman : Iraq has repeatedly accused British and American forces of using cluster bombs. Now there has been a detailed, independen... BBC Reporters' Log: At war in Iraq
Gavin Hewitt, North West Baghdad : The sheer number of people who are cowering in ditches, or walking by the roadside, carrying white flags has ma... BBC Reporters' Log: At war in Iraq
Iraq aid situation 'precarious' CNN – World
Baghdad's hospitals in crisis BBC News | War in Iraq
Funk's WPA Supporting Client. Funk announces Windows client that includes WPA support: Funk will update its Odyssey software to support 802.1x transactions using WPA (Wi-Fi Protected Access) across the Windows platform. Microsoft has already committed to WPA through an update they released last week. Nonetheless, Microsoft's software supports only protocols Microsoft is interested in for secure authentication; Funk's broader support allows enterprises to incorporate legacy systems or to use non-Microsoft/Cisco backend authentication more simply. Funk also supports WPA across Windows 98, Me, 2000, and XP, where Microsoft's initial WPA support is just for XP.... Wi-Fi Networking News
Red Hat touts content management IDG InfoWorld
Noted War Blogger Cops to Copying Wired News – Culture
UN partnership with parliamentarians key to building better world – Annan UN News Service: Peace & Security
Iraqi civilians face crisis BBC News | War in Iraq
Fretting about the future, lost liberty. CNET News.com's Declan McCullaghreports back after a week of hanging with cyberprivacy advocates who contemplate the prospect of life with Big Brother. CNET News.com
Key maps: Guide to the conflict BBC News | War in Iraq
Al Jazeera and the Net - free speech, but don't say that. You can say what you like, so long as not too many people notice The Register
Google Vs. Yahoo: When We Last Met... Slashdot
More Funds Sought for Homeland Security Terrorism RealNews
News Groups Want Terror Case Documents Terrorism RealNews
Silicon Valley Hikes Wireless Frontier. As wireless telephony and computing combine, the center of gravity in digital technology is clearly shifting. By Steve Lohr. New York Times: Business
Mr. Murdoch's War. Rupert Murdoch's stridently hawkish political views make his voice among the loudest in the international debate over the war with Iraq. By David D. Kirkpatrick. New York Times: Business
U.S.: New Iraq Government May Take Time. A new Iraqi-led government likely won't be established for more than six months after the fall of Saddam Hussein's regime, and a U.N.-administered government probably won't happen at all, U.S. officials say. Associated Press war headlines via GoUpstate.com
American Red Cross and Cardiac Science Collaborate to Increase Public Access To Defibrillation in Communities Across the Country PR Newswire: Biotech/Healthcare
Hemingway's Letters to Dietrich Are Given to Library New York Times: Art
IFLA , the international NGO representing the library and information profession on the world stage, is seeking candidates to succeed the curren... Peter Scott's Library Blog
Human shields confront IDF in Gaza Jerusalem Post
Subway Fears, Bioterrorism and Tetanus Shots The Nation
Adobe updates Acrobat for the XML era. Version 6.0 bridges proprietary PDF to open XML The Register
Noted War Blogger Cops to Copying. Sean-Paul Kelley, the man behind the immensely popular Iraq war blog The Agonist, admits he posted information from a highly regarded commercial intelligence company on his site without sourcing it -- and in some cases credited it to unnamed sources. By Daniel Forbes. Wired News
(Anti)War Injury. This is a brutal image of a woman who says she was hit by a "police weapon" (rubber bullets?) during an anti-war protest today in Oakland. Link Discuss (Thanks, Gabe!) Boing Boing Blog
Oakland Police Fire Rubber Bullets at Anti-War Protesters. OAKLAND, Calif. (AP) -- Police opened fire with non-lethal projectiles at an anti-war protest at the Port of Oakland on Monday, injuring at least a dozen demonstrators and six longshoremen standing nearby. By The Associated Press. New York Times: NYT HomePage
Watching Iraq, China begins to lean on North Korea. Bush's 'preemptive strike' policy spurs Beijing into preemptive diplomacy. Christian Science Monitor | Top Stories
In vanguard of 'peaceful occupation'. Civil-affairs troops have been sent to Iraq in their biggest call-up since World War II. Christian Science Monitor | Top Stories
40 million Africans on brink of starvation, Security Council told UN News Service
U.S. Finds Barrels That May Hold Chemical Weapons New York Times: International News
U.S. Tests Possible Chemical Find CBS News: Iraq Crisis
Andrew Marr, Belfast : I think there is one area that is still unresolved between Tony Blair and George Bush, and that is what role the United Nat... BBC Reporters' Log: At war in Iraq
Exclusive: War ‘Against Iraqi People’ ArabNews: World
Rumsfeld: Plans for new Iraqi government unfolding CNN – World
Commentary: Is your search engine experienced?. Yahoo's newly redesigned search interface at search.yahoo.com is the opening move in the new competitive arena for Web search--the user experience. CNET News.com
In quotes: War in Iraq. Views from the protagonists as all sides struggle for propaganda as well as military victories. BBC News | Front Page | UK Edition
Red Hat touts content management, portal apps. The two products have now been integrated with the Red Hat Enterprise operating systems and the Red Hat Enterprise Network, which provides automated software delivery and systems monitoring. Computerworld News
Sun unveils business collaboration platform. The new platform integrates e-mail, instant messaging, calendar, search and content management capabilities. Computerworld News
Iraqi Civilian Wartime Needs Could Grow. The U.S.-British invasion's impact on Iraqi civilians has been less severe than some feared, an American relief coordinator said Monday. But U.N. officials said the power, water and medical breakdowns afflicting Iraq are "critical" and could worsen. Associated Press war headlines via GoUpstate.com
Kerry Defends Right to Criticize Bush. Presidential candidate John Kerry said Monday that democracy affords rival Democrats the right to criticize President Bush even with the nation at war. Associated Press war headlines via GoUpstate.com
Annan Seeks Security Council Iraq Meeting. Laying claim to "an important role" for the United Nations in postwar Iraq, Secretary-General Kofi Annan on Monday stressed that only the world body can bring legitimacy to the work of rebuilding the nation. Associated Press war headlines via GoUpstate.com
W.H.O. Criticizes China Over Handling of Mystery Disease New York Times: International News
Nick Childs, Washington : Donald Rumsfeld is being very cautious about whether the United States has found a so-called smoking gun of chemical wea... BBC Reporters' Log: At war in Iraq
Bernie Dunham
MOUStech.NET, LLC
112 Acorn Drive
Dickson, TN 37055
bdunham@moustech.net
Website: http://www.moustech.net/
Weblog: http://www.moustech.info/
10:39:28 PM
|
|
From: MacCentral http://maccentral.macworld.com/news/0201/22.macmania.php
MacMania plans to offer ship-wide wireless Internet by Dennis Sellers, dsellers@maccentral.com January 22, 2001 7:00 am ET
In what promises to be a good thing for MacMania attendees, Geek Cruises' Perl Whirl II cruise conference, now underway, features the first ship-wide wireless Internet access for attendees.
This network will allow attendees to download conference files, communicate with speakers and other attendees, keep informed of any change in conference venues and participate in activities using state-of-the-art groupware. Plus, the wireless Internet link allows attendees to surf the Web, send and receive e-mail and transfer files to their own laptops using the ship's satellite connection.
6:35:40 PM
|
|
Peace Blogs Added to the Index.
Peace Blogs Added to the Index
I know that Feedster has quite a few "war blogs" regularly being indexed by Feedster -- I wrote the automatic classification routines for the War Filter but it was unclear to me how many, if any, "peace blogs" were in there. So via a pointer from Doc, I found Mark Pilgrim's list of Peace Blogs and made sure that all of the ones for which he points out RSS feeds are now indexed by Feedster. Roughly 1/3 were already being indexed so that's something but I thought it best if they all were.
Note: I'm not getting into the whole war discussion here at all but I do think it important that a search engine cover both sides of things. [The FuzzyBlog!]
5:58:23 PM
|
|
From: VirtualCorporation.com http://www.virtualcorporation.com/default.asp
First Web Conferencing software using multi-point video and audio ... BCBR December: The Virtual Corporation The Virtual Corporation Case Studies - First Virtual Corporation
Web Web Conferencing software using multi-point video and audio ... Virtual Corporation, Inc., Innovative and Adaptive Solutions for ... Your Search Engine Internet directory, information, search engine ... Company Profile and Open Technical Jobs: Virtual Corporation
Technology Web Conferencing software using multi-point video and audio ... Grand Virtual, Inc. MOUStech.NET, LLC: A Virtual Corporation ORGANIZATIONAL PARTNERSHIPS AND THE VIRTUAL CORPORATION
Home Virtual Corporation Homepage Virtual Corporation 1.0 update - Patches Virtual Corporation - Review
Inc Web Conferencing software using multi-point video and audio ... Virtual Corporation, Inc., Innovative and Adaptive Solutions for ...
Information Virtual Corporation, Inc., Innovative and Adaptive Solutions for ... ORGANIZATIONAL PARTNERSHIPS AND THE VIRTUAL CORPORATION
5:07:54 PM
|
|
Excerpts From: MacDevCenter http://www.macdevcenter.com/lpt/a/mac/2002/06/07/cruise.html (click for entire article, including a great photo of very happy Glenn Fleishman with a dog team in Alaska.)
Published on The O'Reilly Network (http://www.oreillynet.com/) http://www.oreillynet.com/pub/a/mac/2002/06/07/cruise.html See this if you're having trouble printing code examples
Wireless at Sea: A Report from the MacMania Alaska Cruiseby Glenn Fleishman 06/07/2002
On the recent Geek Cruises' MacMania conference, I mushed dogs, watched glaciers calve, and ate like a pig. But one of the best parts of the event was the convivial area network (CAN?) in the ship's library and nearby games room, made possible through Wi-Fi networking and a satellite link-up back to the Internet. (Another good part: I somehow lost two pounds. Must have been all the presenting.)
CAN: the Convivial Area Network
When Neil Bauman, CEO and "Captain" of Geek Cruises, and Bernie Dunham of MousTech.Net (no Web site) -- his one-man consulting firm, partnered to deliver wireless access during the conferences, they originally planned to offer it ubiquitously.
Dunham said, "The original project scope was to provide wireless not only over the conference center decks, but we were going to try to get all the cabin areas." After considering the cost and social impact, however, they decided to limit coverage to conference rooms and public areas.
Last fall's Perl Whirl was a free test of the wireless network system for Bauman, Dunham, and the attendees, many of whom said they would have liked to have access in their cabins. "I don't think so!" Bauman said. "Then they'll spend their time in their rooms."
Expensive Service
The cost to attendees and speakers for Wi-Fi access was $100 if paid early, and $150 aboard ship. Bauman said he was subsidizing the service, which cost him $200 per user because of high fees paid to the onboard Internet concessionaire.
Both Dunham and Bauman hope to negotiate better rates as they support and produce more and more cruises. Dunham would like to offer his services for more conferences at sea. So far, he's the only one he's aware of performing ship-by-ship site surveys and actually deploying and supporting wireless networks on cruise lines.
The metal lining of a ship and the resultant reflection make signal propagation a real issue. It's possible that 802.11g and 802.11a, with multipath signal reflection cancellation built into their higher-speed encoding, might perform substantially better. Dunham used a 3Com access point during this cruise, and Bauman said they have permission to run access points on the exterior of the ship to create a larger backbone. Some cruise ships also have interior Ethernet, making it easier to bridge larger networks.
On the Holland-America Line, the only cruise line where Bauman has held his events, the Internet concession is run by Digital Seas. Digital Seas' satellite service for its onboard Internet café ($25 per hour and up) is provided via Marine Telecommunications Network, although both are owned by the same corporate parent, Verestar. Yes indeed, the company is charging itself high rates.
Other lines, such as the Norwegian line, home of MacMania II in June 2003, have direct relationships with Marine Telecommunications, which may allow Dunham and Bauman more flexibility.
4:51:45 PM
|
|
From: Alan Reiter's Wireless Data Web Log: http://reiter.weblogger.com/2002/07/23
 |
| Spontaneous pontifications about wireless data and other personal musings "Forbes" magazine Top 5 Technology Weblog | |
WiFi, cruises, photography and a new Web site and Weblog to check out
As I've written previously, I'm getting involved in promoting the development of 802.11 on board cruise ships. I makes a lot of sense. I'm working with Bernie Dunham, a long-time IT expert who provided the WiFi infrastructure for Geek Cruises and its most recent MacMania cruise. Bernie will continue to provide WiFi for Geek Cruises.
WiFi + cruises Web site and Weblog
Bernie has just posted a new Web site for his company, MOUStech.net, which includes information about his experience in WiFi and seminars that will use 802.11 on cruise ships. MOUStech.net's business is providing WiFi for ships as well as coordinating appropriate seminars and workshops for cruise ships.
I'm going to be presenting a keynote address or two as well as conducting a multi-day seminar about wireless as part of the Caribbean cruise on Royal Caribbean's mammoth "Explorer of the Seas" cruise ship. (Want to become a sponsor? Contact me: reiter@wirelessinternet.com)
There will be several seminars presented by different companies and speakers occurring during the Eastern Caribbean cruise, which is October 5 - 12, 2002. A similar program (without me) will be for the Western Caribbean, October 12 - 19, 2002.
The MOUStech.net Web site is recent, and it's very definitely a work in progress. Bernie also has started a MOUStech.Info Radio Userland Weblog, where there is more information about what he is doing professionally and personally.
Bernie is spearheading the efforts of implementing WiFi on ships, and I'm kind of tagging along on his coattails. When you begin to look at offering wireless data on ships, you begin to see many, many interesting -- and useful possibilities. I wrote last Thursday about how Philippe Kahn was sending photos, via satellite, of his sail boat race. Wireless and photography will be a big business.
Wireless photography
Cruise ships should offer a variety of wireless and wireless photography services. Offer passengers an opportunity to have their own photo page for posting images. Offer passengers Weblogs to post their thoughts. These can be teriffic "electronic postcards." Actually they can be more like electronic letters back home, and passengers don't have to wait until their mail is posted on land.
Sell disposable (non-digital) cameras, develop the film and scan the images into the photo page and/or Weblog. Sell cheap (or not-so-cheap!) digital cameras on board and offer classes about digital photography and about wireless. (Disposable cameras already are sold on cruise ships; I don't know whether digital cameras are now being sold.)
Create splash pages for every cruises -- for the passenger's photo page and Weblog as well as for the ship's own information -- and sell advertising space on the pages to merchants in ports. Obviously, you need to be careful and intelligent about where and how to include advertising. Maybe everyone gets a photo page and Weblog that's free -- with advertising -- or ad-free pages for a small fee.
I e-mailed Bernie about the possibility of establishing photo kiosks on ships, and he said he previously discussed the idea with at least one conference organizer.
There's a business here!
I tell you folks, there are valid business models for using technology to provide passengers -- and merchants (on the ships and on land) -- with valuable and fun services. I'm getting involved in this. Good economy or bad -- there are opportunities to serve the public and generate income. Only the idiots (i.e., many financial analysts) dismiss wireless communications today.
But you must ensure that all the links in the wireless data value chain are sufficiently strong!
Corresponding with Bernie has gotten some of my creative juices flowing, and he certainly is spearheading the WiFi-on-cruises concept. It seems, too, that Weblogger extraordinaire and Linux Journal senior editor Doc Searls provided Bernie with some inspiration.
802.11 in libraries
Bernie does more volunteer work than anyone I know. One of his many projects is installing WiFi in libraries, and you may read about it in his Weblog. WiFi in libraries -- public and corporate -- makes a lot of sense, and I'd like to see more of it. Bernie posts links to other sites with some good information about WiFi in libraries. Well worth checking out.
[Note: Despite what the Weblog indicates, this entry is being posted on Wednesday, July 24. There will be more entries to come today.]
Discuss
4:43:15 PM
|
|
From: Windley.com http://www.windley.com/2003/01/04.html
Windley's Enterprise Computing Weblog Organizations usually get the IT they deserve...
|
Pete Kruckenberg sent me a reference to a Wired story on Wi-Fi on campus after reading my recent article. Pete says "Just like any other technology, Wi-Fi requires that the classroom dynamics and methods be changed to incorporate and use it. " One of the points that the article makes, and with which I agree wholeheartedly, is that there's no telling what will happen on campus when you give everyone access to ubiquitous wireless networking. College students are incredibly innovative and, contrary to what they commonly believe, have a lot of time on their hands to play around with the technology. Just one small example: last week when I was at the BYU CS department, there was a robot running around the third floor. It was using the building Wi-Fi for access, not some special connection. Its just part of the infrastructure that researchers count on now.
|
|
© Copyright 2003. Phillip J. Windley. All rights reserved. Reproduction of all or part of this work is permitted for educational or research use provided that this copyright notice is included in any copy. Last update: 2/1/03; 20:06:57. |
4:37:12 PM
|
|
From: Feedster http://feedster.com/search.php?sort=date&q=Korea
Negotiations Will Go Far With This Man [ From: The Eleven Day Empire | Hide Show All RSS ] North Korea has slipped off the radar screen a bit lately, but it's sure to be front page news again... http://www.elevendayempire.com/movabletype/archives/005594.html - 0.10 K - 2003-04-07T14:41:43-05:00 0 links, 0 pictures
North Korea Cancels Talks With the South [ From: Headlines From The NY Times | Hide Show All RSS ] North Korea canceled talks today with South Korea two days before a debate that opens at the U.N. on the nuclear crisis. By Don Kirk. http://www.nytimes.com/2003/04/07/international/asia/07CND-KORE.html?ex=1050379200&en=89eccd84765b41... - 0.13 K - Mon, 07 Apr 2003 15:55:06 GMT 0 links, 0 pictures
(No Title) [ From: The Agonist | Hide Show All RSS ] via AFP: South Korea said that four-day cabinet-level talks with North Korea scheduled for this week in Pyongyang had been scrapped, effectively freezing ties and deepening a six-month-old nuclear crisis.... http://www.agonist.org/archives/001045.html - 0.20 K - 2003-04-07T09:58:06-05:00 0 links, 0 pictures
Promoting Broadband Networks [ From: Robert Shaw: Broadband | Hide Show All RSS ] The ITU is hosting a workshop this week on the different strategies used by ITU Member States, at both local and national levels, for promoting the deployment and use of broadband networks. The key research question is why some economies have bee http://radio.weblogs.com/0108486/categories/broadband/2003/04/07.html#a256 - 1.48 K - Mon, 07 Apr 2003 10:55:36 GMT 11 links, 0 pictures
Bomb Iraq [ From: Kaffeesud Lesen | Hide Show All RSS ] To the tune of "If you're happy and you know it, clap your hands":If you cannot find Osama, bomb Iraq.If the markets are a drama, bomb Iraq.If the terrorists are frisky,Pakistan is looking shifty,North Korea is too risky,Bomb Iraq.If we have no allies http://www.paumann.net/kopa/index.php?p=16&c=1 - 1.53 K - April 07, 2003, 03:48:32 AM 0 links, 0 pictures
UN CONTROL OF IRAQ [ From: Bo Cowgill.com | Hide Show All RSS ] I'm split. Perhaps I shouldn't trust the UN to set up a decent post-Saddam government in Iraq, but I do. The only non-democratic permanent member of the Security Council is China. They'll try to set up a democracy. The worst they could possibly do http://bocowgill.com.sabren.com#200107464 - 1.19 K - April 07, 2003, 03:38:23 AM 0 links, 0 pictures
Visit Delightful North Korea [ From: Pavloff.Net | Hide Show All RSS ] Well, don't actually, but look at the photos that someone else took and shake your in amazement.... http://www.pavloff.net/archives/2003_04.html#000086 - 0.10 K - 2003-04-06T23:32:10-08:00 0 links, 0 pictures
North Korea Says Its Arms Will Deter U.S. Attack [ From: Headlines From The NY Times | Hide Show All RSS ] North Korea said on Sunday that only by arming itself with a "tremendous military deterrent" could the country guarantee its security. By Howard W. French. http://www.nytimes.com/2003/04/07/international/asia/07KORE.html?ex=1050379200&en=937e9115b190ad7e&e... - 0.15 K - Mon, 07 Apr 2003 04:55:05 GMT 0 links, 0 pictures
Is Bush's real battle with the economy? [ From: unintended consequences | Hide Show All RSS ] Economist Jeff Madrick, writing in today's New York Times Magazine, has a sobering analysis of the state of the US economy and the effects of the war on Iraq (and any sequels against Iraq's neighbours, or N Korea). Madrick begins... http://www.johnbrownlow.com/unintended/archives/2003_04.html#000172 - 0.23 K - 2003-04-06T21:16:33+00:00 0 links, 0 pictures
News Feeds [ From: MOUStech.INFO: A Neutralblog | Hide Show All RSS ] MOUStech.INFO: April 6, 2003 World News, The Week in Hyperlinks : North Korea's pattern of escalation on hold - for now . UN Security Council meets Wednesday to discuss how to handle the nuclear crisis. Christian Science Monitor U http://radio.weblogs.com/0110710/2003/04/06.html#a702 - 64.68 K - Mon, 07 Apr 2003 01:47:34 GMT 142 links, 0 pictures comments
Department stores sales tumble in first quarter [ From: pls.sprd.ve.news.frm.ths.vrtl.intl.press.room/tks | Hide Show All RSS ] Korea HeraldPlagued by growing concerns about warfare in Iraq and the spread of the deadly SARS virus in China and Hong Kong, first quarter sales posted at major department stores were found to have plunged on-year, sources said yesterday. According to http://adam.antville.org/stories/342558/ - 0.50 K - 2003-04-07T02:06:58+01:00 0 links, 0 pictures
(No Title) [ From: Craig Cline's Radio Weblog | Hide Show All RSS ] I received another email from Jonathan Seybold this weekend. I can see no othe reason for neo-conservative's willing ness to plunge American into financial maliase than a fanatical, almost kamakazi belief that if you destory the government by rende http://radio.weblogs.com/0114406/2003/04/06.html#a32 - 23.13 K - Sun, 06 Apr 2003 22:53:49 GMT 0 links, 0 pictures comments
Will US Soon Shift War Against Axis of Evil to North Korea? [ From: MOUStech.INFO: A Neutralblog | Hide Show All RSS ] North Korea and the US 'on a slide towards conflict'. World: War in North Korea is now almost inevitable, a senior UN official claims. [ Guardian Unlimited ] http://radio.weblogs.com/0110710/2003/04/06.html#a696 - 0.29 K - Sun, 06 Apr 2003 21:14:58 GMT 2 links, 0 pictures comments
Beware of Japan [ From: Ciao! | Hide Show All RSS ] I'm not so sure North Korea is a threat to us anymore. I've come to the conclusion that Japan probably... http://www.centellas.org/miguel/archives/000225.html - 0.10 K - 2003-04-06T15:23:55-05:00 0 links, 0 pictures
United Nations Security Council Condemned by North Korea: "Prelude to War" [ From: MOUStech.INFO: A Neutralblog | Hide Show All RSS ] N Korea condemns UN 'meddling'. The Security Council meeting over the North Korean nuclear crisis is a prelude to war, says Pyongyang. [ BBC News | Front Page | UK Edition ] http://radio.weblogs.com/0110710/2003/04/06.html#a692 - 0.31 K - Sun, 06 Apr 2003 20:19:03 GMT 2 links, 0 pictures comments
(No Title) [ From: this particular weblog... | Hide Show All RSS ] World Gone Mad: Axi of Evil ( Andrew Marlatt ) Bitter after being snubbed for membership in the "Axis of Evil", Libya, China, and Syria today announced that they had formed the "Axis of Just as Evil", which they said would be more evil than th http://radio.weblogs.com/0104156/2003/04/06.html#a523 - 5.03 K - Sun, 06 Apr 2003 19:29:36 GMT 2 links, 0 pictures comments
After Iraq, North Korea [ From: AlterNet: War on Iraq | Hide Show All RSS ] Get ready for the next war, says Maurice Strong, special adviser to the Secretary General Kofi Annan, who believes that a war between... http://www.alternet.org/waroniraq/2003/04/000611.html - 0.13 K - April 06, 2003, 01:50:18 PM 0 links, 0 pictures
Antiwar.com Hyperlinks to World Coverage of War in Iraq [ From: MOUStech.INFO: A Neutralblog | Hide Show All RSS ] Headlines from Antiwar.com :'Friendly Fire' Kills 17 in US-Kurdish Convoy Ex-General to Take Over Iraq 'Government' Next Week Neoconservatives' Postwar Vision: American Empire Wolfowitz of Arabia: Postwar Iraq a Bureaucratic Battlefield Britis http://radio.weblogs.com/0110710/2003/04/06.html#a678 - 33.13 K - Sun, 06 Apr 2003 17:33:52 GMT 74 links, 70 pictures comments
UN To Talk About North Korea [ From: NeoFlux.com Propaganda You Can Trust | Hide Show All RSS ] The UN is finally going to start talking about the North Korea problem next week. I'll be watching this one closely to see how the first difficult situation to arise since the Iraq debacle.... http://www.neoflux.com/archive/data/002725.shtml - 0.19 K - April 06, 2003, 11:22:13 AM 0 links, 0 pictures
Blogger News Item [ From: bloggerApiTestmanilasitescom News | Hide Show All RSS ] axis of evil Bush describing Iran, Iraq, and North Korea ... axis of weasels description of UN members voting against the war ... waxes on easels artists who use wax moldings ... taxes on measles new way to pay for the war . [ The Pers http://bloggerApiTest.manilasites.com/2003/04/06#a21168 - 0.39 K - April 06, 2003, 10:35:50 AM 1 links, 0 pictures
HIT ME! I SAID HIT ME! [ From: unigolyn | Hide Show All RSS ] Via the Command Post. Pyongyang condemns security council meeting, balks at talks with Seoul Okay, that does it. They are completely barking mad. Insane. Off their rockers. Looney tunes. North Korea accused the United States of using UN Security Counci http://www.unigolyn.com/archives/000122.html - 0.25 K - 2003-04-06T16:58:03+02:00 0 links, 0 pictures
North Korea is Upset. Go Figure. [ From: Tocq Magazine TocqLogBlog | Hide Show All RSS ] It seems the United States has trampled down the people's dream to live free from murder: "The war in which... http://www.tocquevillian.com/tocqlogarchives/000891.html - 0.11 K - 2003-04-06T06:11:08-05:00 0 links, 0 pictures
Pyongyang condemns security council meeting, balks at talks with Seoul [ From: The Command Post | Hide Show All RSS ] North Korea accused the United States of using UN Security Council discussions of its nuclear program as a "prelude to war" and warned that it would fully mobilize and reinforce its forces. The US-led war in Iraq, however, has raised... http://www.command-post.org/archives/004192.html - 0.23 K - 2003-04-06T06:02:06-05:00 0 links, 0 pictures
Korea and policy from Hell [ From: ibidem | Hide Show All RSS ] ALL triplets in North Korea are being forcibly removed from parents after their birth and dumped in bleak orphanages. The policy is carried out... http://ibidem.blogmosis.com/archives/006651.html - 0.14 K - 2003-04-06T11:49:54+01:00 0 links, 0 pictures
Who's next? Everyone. [ From: unintended consequences | Hide Show All RSS ] Seems the papers and news sites are full of nothing this weekend but wars and rumours of wars against anyone but I-raq. The Observer has a frightening piece by Tracey McVeigh that says: War in North Korea is now almost... http://www.johnbrownlow.com/unintended/archives/2003_04.html#000167 - 0.22 K - 2003-04-06T05:20:35+00:00 0 links, 0 pictures
Blogger News Item [ From: bloggerApiTestmanilasitescom News | Hide Show All RSS ] North Korea and the US 'on a slide towards conflict' "War in North Korea is now almost inevitable because of the country's diplomatic stalemate with America, a senior UN official claims. Ahead of this week's crucial talks between member http://bloggerApiTest.manilasites.com/2003/04/06#a21154 - 0.97 K - April 06, 2003, 04:11:26 AM 1 links, 0 pictures
Blogger News Item $50 million to investigate a blowjob, but only $3 million for 9/11. Read more about your Republican congress at Joe's place . Friday morning on NPR, I heard that China mysteriously cut off the flow of oil to North Korea recently. Since they prov http://bloggerApiTest.manilasites.com/2003/04/06#a21153 - 1.24 K - April 06, 2003, 03:58:00 AM 1 links, 0 pictures
(No Title) [ From: Playing with my food, and other things... | Hide Show All RSS ] White bread: $50 million to investigate a blowjob, but only $3 million for 9/11. Read more about your Republican congress priorities at Joe's place . Friday morning on NPR, I heard that China mysteriously cut off the flow of oil to North Korea http://blogs.salon.com/0001444/2003/04/06.html#a879 - 1.71 K - Sun, 06 Apr 2003 08:56:11 GMT 2 links, 0 pictures comments
Antiwar.com [ From: onRelease() | Hide Show All RSS ] A conqueror talks: Geoff Hoon, the [UK] Defence Secretary, suggested yesterday that mothers of Iraqi children killed by cluster bombs would "one day" thank Britain for their use [1].Free-speech on the Net, yeah right: Akamai pulls Al-Jazeera Web suppor http://www.onrelease.org/index.php?p=79769984&c=1 - 1.12 K - April 06, 2003, 03:34:32 AM 0 links, 0 pictures
Moon recovers from illness. [ From: Moonie World | Hide Show All RSS ] Sun Myung Moon recently spent time in a hospital after his return from Korea. SARS was considered as the cause of his severe cold, but it was discounted, and he was released. Did Moon's people send this suburban New York newspaper a press release http://moonieworld.blogspot.com#200091714 - 0.44 K - April 06, 2003, 03:06:42 AM 1 links, 0 pictures
Late Night Food for Thought [ From: Eschaton | Hide Show All RSS ] First, from No More Mister Nice Blog: I've been worried about this [Iran] ever since I saw the following on page 276 of David Frum's Bush White House memoir, The Right Man: The war on terror, by its very nature, yielded few spectacular vic http://atrios.blogspot.com#200103562 - 2.38 K - April 05, 2003, 11:31:51 PM 3 links, 0 pictures
Observer | North Korea and the US 'on a slide towards conflict' [ From: Blog Left: Critical Interventions | Hide Show All RSS ] Sooner or later Bush's axis of evil will produce apocalypse, another danger looms of Bush failure to do diplomacy and militarist proliferations Observer | North Korea and the US 'on a slide towards conflict' http://www.gseis.ucla.edu/courses/ed253a/blogger.php#200103566 - 0.28 K - April 05, 2003, 11:21:31 PM 1 links, 0 pictures
Buddhist precepts revised for modern life [ From: The Lost Olive | Hide Show All RSS ] Buddhist News Network - Archive "'I cannot return to my homeland, Vietnam, and China is not a country where I can make this announcement,' said Thich Nhat Hanh. “Japan no longer needs precepts, and in France, where I live now, less than 1 percent of th http://thelostolive.net/~kstamour/cgi-bin/mt/archives/000240.html - 0.58 K - 2003-04-05T15:32:53-05:00 0 links, 0 pictures
(No Title) [ From: sysrick.com | Hide Show All RSS ] From the e-Mailbox... Hello, This message has been sent to you for good luck. It has been around the world dozens of times. Now it has come to you. You will receive good luck within a week of receiving this message -- provided that you s http://sysrick.com/2003/04/05.html#a1998 - 3.01 K - Sat, 05 Apr 2003 20:13:05 GMT 3 links, 0 pictures
Antiwar.com [ From: onRelease() | Hide Show All RSS ] A conqueror talks: Geoff Hoon, the [UK] Defence Secretary, suggested yesterday that mothers of Iraqi children killed by cluster bombs would "one day" thank Britain for their use [1].Free-speech on the Net, yeah right: Akamai pulls Al-Jazeera Web suppor http://www.onrelease.org/index.php?p=79769984&c=1 - 1.12 K - April 05, 2003, 11:45:18 AM 0 links, 0 pictures
Slap and Kiss [ From: MEET THE G | Hide Show All RSS ] It may be true, a stupendous victory in the Gulf validates the Pentagon planners so it ll be tally ho chaps and some more illegal bombing in countries of our choosing . Caveat, I m sure they wouldn t like to see the bomb used in North Korea. Some http://meettheg.com/archives/consensus_terrorism/2003/04/slap_and_kiss.php - 0.32 K - 2003-04-05T18:14:10+01:00 0 links, 0 pictures
(No Title) [ From: Now Just One Minute | Hide Show All RSS ] N. Korea Warns It'll Ignore U.N. on Nukes [ AP World News ] http://radio.weblogs.com/0109990/2003/04/05.html#a1362 - 0.19 K - Sat, 05 Apr 2003 15:42:23 GMT 2 links, 0 pictures
North Korea [ From: Blogcritics | Hide Show All RSS ] Kim Jong-il has been busy lately. You just haven't heard much about it because of the war in Iraq. For... http://www.blogcritics.org/archives/2003/04/05/091602.php - 0.10 K - 2003-04-05T09:16:02-05:00 0 links, 0 pictures
Rumsfeld and North Korea are Right [ From: Easter Lemming - Liberal News | Hide Show All RSS ] Rumsfeld and North Korea are Right http://elemming2.blogspot.com#200100850 - 0.03 K - April 05, 2003, 04:32:57 AM 0 links, 0 pictures
Risky Business [ From: Caerdroia | Hide Show All RSS ] There is no nation on Earth which can win a stand-up fight against the US, even on their home territory, assuming that nuclear weapons are not used. China would make us bleed from sheer numbers. N. Korea would make us bleed from numbers and terrain. Br http://www.caerdroia.org/blog/archives/000069.html - 0.27 K - 2003-04-05T00:30:40-06:00 0 links, 0 pictures
New York Times: South Korea moves to rescue its 9 credit card companies [ From: Scott Loftesness: Payments News from Glenbrook Partners | Hide Show All RSS ] Don Kirk reports on the efforts now underway to rescue the Korean credit card companies from bankruptcy. With more than $10 billion in debts falling due over the next three months, however, officials believed they had no choice but to compel banks, ins http://www.nytimes.com/2003/04/05/business/worldbusiness/05CRED.html - 0.67 K - Sat, 05 Apr 2003 03:26:50 GMT 0 links, 0 pictures
International Red Cross Hyperlinks [ From: MOUStech.INFO: A Neutralblog | Hide Show All RSS ] Other Red Cross and Red Crescent sites Who's who International Red Cross and Red Crescent Movement main site Emergency items catalogue ICRC main site help ICRC family news network Foundation for the ICRC Corporate Design Guidelines http://radio.weblogs.com/0110710/2003/04/04.html#a673 - 12.97 K - Sat, 05 Apr 2003 03:01:14 GMT 112 links, 1 pictures comments
South Korea Moves to Rescue Its 9 Credit Card Companies [ From: Headlines From The NY Times | Hide Show All RSS ] South Korea's biggest companies and banks began pouring about $4 billion into their credit card companies as part of a government-driven plan to rescue them from bankruptcy and stave off another economic crisis. By Don Kirk. http://www.nytimes.com/2003/04/05/business/worldbusiness/05CRED.html?ex=1050123600&en=b3ddb907d322b2... - 0.22 K - Sat, 05 Apr 2003 02:55:11 GMT 0 links, 0 pictures
Political Humor [ From: Sounding Circle | Hide Show All RSS ] Late Night Comments Re: WarBUZZFLASH NEWS ANALYSISBuzzFlash Note: This collection of jokes was compiled by Daniel Kurtzman and can be found, with updates, here ."The United States Central Command of the Armed Forces has asked Geraldo Rivera to leave I http://www.newciv.org/nl/newslog.php/__show_article/_a000195-000093/ - 3.19 K - April 04, 2003, 08:26:31 PM 1 links, 0 pictures
North Korea Calls Missile Production an 'Indisputable Right' [ From: Headlines From The NY Times | Hide Show All RSS ] North Korea defied United States sanctions today on exports of missile technology that American officials fear could be a prelude to sale of nuclear warheads to rogue nations worldwide. By Don Kirk. http://www.nytimes.com/2003/04/04/international/asia/04CND-KOREA.html?ex=1050123600&en=2b670aaf64ea9... - 0.19 K - Fri, 04 Apr 2003 23:55:08 GMT 0 links, 0 pictures
CAMPUS VIEWPOINT ON IRAQ [ From: Bo Cowgill.com | Hide Show All RSS ] So, I'll be writing a Daily op-ed in support of the war on Iraq. I realize its rather late, but there is clearly discussion continuing on the subject. My basic argument is: If North Korea can get nuclear weapons and longrange missiles in spite of a wea http://bocowgill.com.sabren.com#200099176 - 0.30 K - April 04, 2003, 03:47:35 PM 0 links, 0 pictures
The Axis of Zoophiles [ From: bit.ch | Hide Show All RSS ] Andrew Marlatt, SatireWire: Passed Over, Syria, China, Libya Form Axis of Just As EvilBitter after being snubbed for membership in the "Axis of Evil", Libya, China and Syria today announced that they had formed the "Axis of Just as Evil", which they sa http://bit.ch/138.php - 2.73 K - Fri, 04 Apr 2003 16:29:38 +0100 0 links, 0 pictures
Bill Gates "dead" rumour causes panic in South Korea [ From: SHITHAPPENS | Hide Show All RSS ] AN UNSUBSTANTIATED RUMOUR that Bill Gates had been shot dead in Los Angeles caused share prices on the South Korean stock exchange to slump as panic selling ensued.The rumour, started on a web site, was broadcast over South Korean TV and that caused ot http://sh1.antville.org/stories/340349/ - 0.32 K - 2003-04-04T14:16:45+01:00 0 links, 0 pictures
As in Korea, Viet Nam, US Coalition now Controls 55% of Iraq [ From: MOUStech.INFO: A Neutralblog | Hide Show All RSS ] Airport 'under US control'. 12.45pm: Five killed in 'suicide attack' US: 320 Iraqis killed at airport 'Saddam has lost 45% of Iraq' [ Guardian Unlimited ] http://radio.weblogs.com/0110710/2003/04/04.html#a656 - 0.28 K - Fri, 04 Apr 2003 12:58:27 GMT 2 links, 0 pictures comments
4:17:30 PM
|
|
MOUStech.INFO April 7, 2003: Buddhist Texts Online
From: Primary Zen Texts http://www.io.com/~snewton/zen/primary-texts.html
Steven E. Newton / snewton@io.com / May 27, 2001
These documents are central texts on the Zen Buddhist tradition.
About Buddhism
These are modern (early 20th century) compilations of the Buddhist Canon by Paul Carus, and are suitable for casual readers who want to get a sense of what Buddhism is about: Buddha, the Gospel Buddha, the Word 101,164 bytes
These are collections of files harvested from the Internet on these popular Buddhist topics: Tibetan Buddhism: Archives Zen Buddhism: Archives
Journal Articles about Buddhism This is a collection of academic journal articles about Buddhism from the 19th Century, contributed thanks to Chris Weimer.
Southern Buddhism
The Dhammapada and The Sutta Nipâta, Dhammapada tr. by Max Müller; Sutta-Nipâta tr. by V. Fausböll [1881] (Sacred Books of the East, vol. 10)
Buddhist Suttas Translated from Pâli by T.W. Rhys Davids [1881] (Sacred Books of the East, Vol. 11)
Vinaya Texts (Part I) Translated from the Pâli by T.W. Rhys Davids and Herman Oldenberg. [1881] The Pâtimokkha and The Mahâvagga, I-IV. (Sacred Books of the East, Vol. 13).
Dialogues of the Buddha (The Dîgha-Nikâya) Translated from the Pâli by T.W. Rhys Davids; London, H. Frowde, Oxford University Press [1899] Volume II of the Sacred Books of the Buddhists.
Buddhism in Translations by Henry Clarke Warren [1896] This is a often-cited scholarly anthology of translations of key Theravada Buddhist documents.
The Udâna Translated by Dawsonne Melanchthon Strong [1902] (Redacted by Chris Weimer)
For more translations of Southern Buddhist texts, we highly recommend Access to Insight [External Site].
Northern Buddhism
Buddhist Mahâyâ Texts [1894] Translated by E.B. Cowell, F Max Müller, and J Kakakusu. Sacred Books of the East, Volume 49.
Saddharma-pundarîka (The Lotus Sutra) Translated By H. Kern (Sacred Books of the East Vol. 21) [1884]
She-rab Dong-bu (The Tree of Wisdom) by Nagarjuna; edited and translated by W. L. Cambell [1919] An influential Tibetan Buddhist text.
The Awakening of Faith of Ashvagosha translated by Timothy Richard [1907]
Buddhism In Tibet by Emil Schlaginteweit [1863] A comprehensive look at Tibetan Buddhism.
The Religion of the Samurai by Kaiten Nukariya [1913] This book focuses on Northern (Mahayana) Buddhism, and Zen Buddhism in particular. It includes a wealth of detail as well as very lucid explanations of Zen Buddhist concepts.
Manual of Zen Buddhism by Daisetz Teitaro Suzuki. [1935] Suzuki is one of the most popular 20th century writers about Zen Buddhism. This book is an anthology of texts relating to Zen. Includes the famous 'Ox-Herder' illustrations.
Gleanings In Buddha-Fields by Lafcadio Hearn [1897].
The Book of Tea by Kakuzo Okakura 108,498 bytes. This book discusses the aesthetics of the Japanese Tea Ceremony, and its connection to the Japanese world-view as a whole.
From: The World-Wide Web Virtual Library http://villa.lakes.com/cdpatton/ETexts.html
Buddhist Studies - Texts Input/Translation Projects
General Information Sites Regarding Buddhist Texts
- Access to Insight (world.std.com, USA) ***
[This website presents a wealth of material regarding the Pali Canon of the Theravata tradition, including English translations from the Canon itself, as well as texts discussing the philosophical issues contained therein. Much of the material found here was original inputted by DharmaNet.]
- Dharmanet International
[DharmaNet is home to the DharmaNet Book Transcription Project and other resources. The most significant textual work performed by DharmaNet is the production of e-text versions of Buddhist Publication Society booklets.]
- DharmaNet Online Library (DEFA) (www.dharmanet.org, USA)
[Central library for the DharmaNet Book Transcription Project, which has been transcribing to electronic format English language translations of mostly Theravada related texts. All electronic editions are prepared and made available for free distribution by arrangement with the authors and/or original publishers. Translations, commentary, exposition, scholarly, etc.]
- Numata Center for Buddhist Translation & Research (The Numata Center,USA)
[The non-profit publisher of the BDK English Tripitaka translation of the entire Buddhist canon.]
Specific Buddhist Texts Available Online
- Culasunnatta Sutta (Quintessence of Buddhism) (www.well.com, USA)
[Culasunnatta Sutta - The Quintessence of Buddhism or Seven Steps to Nirvana. The Sutta (121). An excerpt from "A Treasury of the Buddha's Words" (Discourses from the Middle Collection); translated by Ven. Nyanamoli Thera; edited and arranged by Phra Khantipalo, Wat Bovoranives Vihara, Bangkok, Thailand]
- The Diamond Sutra (Minnesota, USA)
[The Gateless Passage's English Translation of the Diamond Sutra]
- Nagarjuna's commentary on 'The Great Perfection of Wisdom Sutra' (www.kalvinka.org, USA)
[Nagarjuna's Commentary on The Great Perfection of Wisdom Sutra (Mahaapraj~naapaaramitaa Upadesha) is an immense exegesis to the Mahaapraj~naapaaramitaa Sutra in 25,000 lines. Classically, it is preserved only in a 100-fascicle Chinese edition translated from Sanskrit in 405c.e. by Kumarajiva, the brilliant and prolific translator-monk who was the premier transmitter to the Chinese of the Maadhyamika teachings of Nagarjuna. Although presented in the form of an exegesis, it is actually a compendium of Dharma jewels as interpreted by one of the most illustrious Indian masters of the Middle Way. All material is rendered directly from the Chinese (Taisho).]
- Vimalakirti Nirdesa Sutra (www.l0pht.com,USA)
[227 Kb strong document, translated from Tibetan by Robert A. F. Thurman copyright 1976, The Pennsylvania State University]
- The Wheel of Life (www.infinite.org,USA)
[The Meaning of Life (Materials from a Dharma discourse by HH the Dalai Lama. Published by Wisdom Publications); Liberation in Our Hands (Materials from the Lam Rim teaching. Published by The Mahayana Sutra and Tantra Press); Nagarjuna's Letter to the King, 1st century AD]
- see also Zen Documents and Writings section of the Zen Buddhism WWW Virtual Library (www.ciolek.com, Australia)
Back to Buddhist Studies WWW Virtual Library
From: Access to Insight http://www.accesstoinsight.org/
|
|
|
Access to Insight
Readings in Theravada Buddhism |
The Path to Freedom
An introductory self-guided tour of the Buddha's teachings, based on excerpts from the Pali Canon.
The Pali Canon
An outline of the Pali Canon (Tipitaka), including a selection of modern translations of over 800 important suttas, all indexed by sutta name, subject, proper names, and similes.
Theravada Text Archives
A library of some 200 books, essays, and transcribed Dhamma talks by masters from the Thai forest traditions, various authors from the Buddhist Publication Society, and other contemporary writers. Also included are Study Guides on selected topics of interest to students of Buddhism.
The three divisions of the Tipitaka are:
- Vinaya Pitaka
The collection of texts concerning the rules of conduct governing the daily affairs within the Sangha -- the community of bhikkhus (ordained monks) and bhikkhunis (ordained nuns). Far more than merely a list of rules, the Vinaya Pitaka also includes the stories behind the origin of each rule, providing a detailed account of the Buddha's solution to the question of how to maintain communal harmony within a large and diverse spiritual community.
- Sutta Pitaka
The collection of suttas, or discourses, attributed to the Buddha and a few of his closest disciples, containing all the central teachings of Theravada Buddhism. (Over eight hundred sutta translations are available on this website.) The suttas are divided among five nikayas (collections):
- Abhidhamma Pitaka
The collection of texts in which the underlying doctrinal principles presented in the Sutta Pitaka are reworked and reorganized into a systematic framework that can be applied to an investigation into the nature of mind and matter.
Digha Nikaya
The Long Discourses
(selected suttas)
- Samaññaphala Sutta (DN 2) -- The Fruits of the Contemplative Life {D i 47} [Thanissaro Bhikkhu, trans.]. King Ajatasattu asks the Buddha, "What are the fruits of the contemplative life, visible in the here and now?" The Buddha replies by painting a comprehensive portrait of the Buddhist path of training, illustrating each stage of the training with vivid similes.
- Kevatta (Kevaddha) Sutta (DN 11) -- To Kevatta (Kevaddha) {D i 211} [Thanissaro Bhikkhu, trans.]. This discourse explores the role of miracles and conversations with heavenly beings as a possible basis for faith and belief. The Buddha does not deny the reality of such experiences, but he points out that -- of all possible miracles -- the only reliable one is the miracle of instruction in the proper training of the mind. As for heavenly beings, they are subject to greed, anger, and delusion, and so the information they give -- especially with regard to the miracle of instruction -- is not necessarily trustworthy. Thus the only valid basis for faith is the instruction that, when followed, brings about the end of one's own mental defilements. The tale that concludes the discourse is one of the finest examples of the early Buddhist sense of humor. [This summary provided by Thanissaro Bhikkhu]
- Lohicca Sutta (DN 12) -- To Lohicca {D i 224} [Thanissaro Bhikkhu, trans.]. A non-Buddhist poses some good questions: If Dhamma is something that one must realize for oneself, then what is the role of a teacher? Are there any teachers who don't deserve some sort of criticism? The Buddha's reply includes a sweeping summary of the entire path of practice.
- Maha-nidana Sutta (DN 15) -- The Great Causes Discourse {D ii 55} [Thanissaro Bhikkhu, trans.]. One of the most profound discourses in the Pali Canon, which gives an extended treatment of the teachings of dependent co-arising (paticca samuppada) and not-self (anatta) in an outlined context of how these teachings function in practice. An explanatory preface is included.
- Maha-parinibbana Sutta (DN 16) -- The Last Days of the Buddha {D ii 72} [Sister Vajira and Francis Story, trans. (complete text) | Thanissaro Bhikkhu, trans. (excerpt)]. This wide-ranging sutta, the longest one in the Pali Canon, describes the events leading up to, during, and immediately following the death and final release (parinibbana) of the Buddha. This colorful narrative contains a wealth of Dhamma teachings, including the Buddha's final instructions that defined how Buddhism would be lived and practiced long after the Buddha's death -- even to this day. But this sutta also depicts, in simple language, the poignant human drama that unfolds among the Buddha's many devoted followers around the time of the death of their beloved teacher.
- Maha-samaya Sutta (DN 20) -- The Great Meeting {D ii 253} [Piyadassi Thera, trans. | Thanissaro Bhikkhu, trans.]. A large group of devas pays a visit to the Buddha. This sutta is the closest thing in the Pali Canon to a "who's who" of the deva worlds, providing useful material for anyone interested in the cosmology of early Buddhism.
- Sakka-pañha Sutta (DN 21) -- Sakka's Questions (excerpt) {D ii 263} [Thanissaro Bhikkhu, trans.]. Sakka, the deva-king, asks the Buddha about the sources of conflict, and about the path of practice that can bring it to an end. This discourse ends with a humorous account about Sakka's frustration in trying to learn the Dhamma from other contemplatives. It's hard to find a teacher when you're a king.
- Maha-satipatthana Sutta (DN 22) -- The Great Frames of Reference (The Great Discourse on the Foundations of Mindfulness) {D ii 289} [Thanissaro Bhikkhu, trans.]. This sutta offers comprehensive practical instructions on the development of mindfulness in meditation. The Buddha describes how the development of continuous mindfulness of the four satipatthana ("foundations of mindfulness," or "frames of reference") -- mindfulness of the body, of feelings, of the mind, and of mind-objects -- can lead ultimately to full Awakening. [The text of this sutta is identical to that of the Satipatthana Sutta (MN 10), except that the Majjhima version omits the exposition of the Four Noble Truths (sections 5a,b,c and d in part D of this version).]
- Cakkavatti Sutta (DN 26) -- The Wheel-turning Emperor (excerpt) {D iii 58} [Thanissaro Bhikkhu, trans.]. In this excerpt the Buddha explains how skillful action can result in the best kind of long life, the best kind of beauty, the best kind of happiness.
- Sigalovada Sutta (DN 31) -- To Sigala/The Layperson's Code of Discipline {D iii 180} [Narada Thera, trans.]. The householder's code of discipline, as described by the Buddha to the layman Sigala. This sutta offers valuable advice on how householders should conduct themselves in relationships with parents, spouses, children, pupils, teachers, employers, employees, friends, and spiritual mentors.
- Atanatiya Sutta (DN 32) -- The Discourse on Atanatiya {D iii 194} [Piyadassi Thera, trans.]. One of the "protective verses" (paritta) that are chanted to this day for ceremonial purposes by Theravada monks and nuns around the world. See Piyadassi Thera's The Book of Protection (Kandy: Buddhist Publication Society, 1999).
Majjhima Nikaya
The Middle Length Discourses
(selected suttas)
- Mulapariyaya Sutta (MN 1) -- The Root Sequence {M i 1} [Thanissaro Bhikkhu, trans.]. In this difficult but important sutta the Buddha reviews in depth one of the most fundamental principles of Buddhist thought and practice: namely, that there is no thing -- not even Nibbana itself -- that can rightly be regarded as the source from which all phenomena and experience emerge.
- Sabbasava Sutta (MN 2) -- All the Fermentations {M i 6} [Thanissaro Bhikkhu, trans.]. The Buddha teaches seven methods for eliminating from the mind the deeply rooted defilements (sensuality, becoming, views, and ignorance) that obstruct the realization of Awakening.
- Bhaya-bherava Sutta (MN 4) -- Fear & Terror {M i 16} [Thanissaro Bhikkhu, trans.]. What would it take to live in solitude in the wilderness, completely free of fear? The Buddha explains.
- Vatthupama Sutta (MN 7) -- The Simile of the Cloth {M i 36} [Nyanaponika Thera, trans.]. With a simple simile the Buddha illustrates the difference between a defiled mind and a pure mind. [BB]
- Sallekha Sutta (MN 8) -- The Discourse on Effacement {M i 40} [Nyanaponika Thera, trans.]. The Buddha explains how the unskillful qualities in the heart can be eradicated through meditation.
- Sammaditthi Sutta (MN 9) -- The Discourse on Right View {M i 46} [Ñanamoli Thera and Bhikkhu Bodhi, trans.]. A long and important discourse by Ven. Sariputta, with separate sections on the wholesome and the unwholesome, nutriment, the Four Noble Truths, the twelve factors of dependent origination, and the taints. [BB]
- Satipatthana Sutta (MN 10) -- Frames of Reference/Foundations of Mindfulness {M i 55} [Nyanasatta Thera, trans. | Soma Thera, trans. |Thanissaro Bhikkhu, trans. ]. The Buddha's comprehensive practical instructions on the development of mindfulness. [The text of this sutta is identical to that of the Maha-satipatthana Sutta (DN 22), except that the latter contains a more detailed exposition of the Four Noble Truths (sections 5a,b,c and d in part D of that version).]
- Cula-sihanada Sutta (MN 11) -- The Shorter Discourse on the Lion's Roar {M i 63} [Ñanamoli Thera and Bhikkhu Bodhi, trans.]. The Buddha declares that only through practicing in accord with the Dhamma can Awakening be realized. His teaching is distinguished from those of other religions and philosophies through its unique rejection of all doctrines of self. [BB]
- Maha-sihanada Sutta (MN 12) -- The Great Discourse on the Lion's Roar {M i 68} [Ñanamoli Thera and Bhikkhu Bodhi, trans.]. The Buddha expounds the ten powers of a Tathagata, his four kinds of intrepidity, and other superior qualities which entitle him to "roar his lion's roar in the assemblies." [BB]
- Maha-dukkhakkhandha Sutta (MN 13) -- The Greater Discourse on the Mass of Suffering {M i 91} (excerpt) [Thanissaro Bhikkhu, trans.]. In this excerpt, the Buddha describes the drawbacks of the pursuit of sensual pleasures. Such pursuits invariably result in pain and unhappiness.
- Madhupindika Sutta (MN 18) -- The Ball of Honey {M i 108} [Thanissaro Bhikkhu, trans.]. A man looking to pick a fight asks the Buddha to explain his doctrine. The Buddha's answer mystifies not only the man, but also a number of monks. Ven. Maha Kaccana finally provides an explanation, and in the course of doing so explains what is needed to bring the psychological sources of conflict to an end.
- Dvedhavitakka Sutta (MN 19) -- Two Sorts of Thinking {M i 114} [Thanissaro Bhikkhu, trans.]. The Buddha recounts the events leading up to his Awakening, and describes his discovery that thoughts connected with sensuality, ill-will, and harmfulness do not lead one to Awakening, while those connected with their opposites (renunciation, non ill-will, and harmlessnes) do.
- Vitakkasanthana Sutta (MN 20) -- The Relaxation of Thoughts {M i 118} [Thanissaro Bhikkhu, trans. | Soma Thera, trans.]. The Buddha offers five practical methods of responding wisely to unskillful thoughts (thoughts connected with desire, aversion, or delusion).
- Kakacupama Sutta (MN 21) -- The Simile of the Saw {M i 122} (excerpt) [Thanissaro Bhikkhu, trans.]. The Buddha tells the story of a wise slave who deliberately tests her mistress's patience. The Buddha invokes several memorable similes here to illustrate how we should develop patience.
- Ratha-vinita Sutta (MN 24) -- Relay Chariots {M i 145} [Thanissaro Bhikkhu, trans.]. Using the simile of a set of relay chariots, Ven. Punna Mantaniputta explains the relationship of the factors of the path to the goal of the holy life. [TB]
- Maha-Saccaka Sutta (MN 36) -- The Greater Discourse to Saccaka {M i 237} (excerpt) [Thanissaro Bhikkhu, trans.]. In this excerpt, the Buddha recounts his early meditation practices and austerities that led him finally to discover the path to Awakening.
- Saleyyaka Sutta (MN 41) -- The Brahmans of Sala {M i 285} [Ñanamoli Thera, trans.]. The Buddha explains to a group of brahman householders how one's present actions -- by body, speech, and mind -- determine one's future fortune.
- Cula-vedalla Sutta (MN 44) -- The Shorter Set of Questions-and-Answers {M i 299} [Thanissaro Bhikkhu, trans.]. Dhammadinna the nun fields a series of Dhamma questions put to her by her former husband: questions on self-identification, cessation, penetration into the true nature of feeling, and the attainment of Nibbana.
- Cula-dhammasamadana Sutta (MN 45) -- The Shorter Discourse on Taking on Practices {M i 305} [Thanissaro Bhikkhu, trans.]. Is something right because it feels right? [TB]
- Kukkuravatika Sutta (MN 57) -- The Dog-duty Ascetic {M i 387} [Ñanamoli Thera, trans.]. Act like a dog, and that's what you'll become. Choose your actions with care!
- Abhaya Sutta (MN 58) -- To Prince Abhaya (On Right Speech) {M i 392} [Thanissaro Bhikkhu, trans.]. The Buddha explains the criteria for determining whether or not something is worth saying. This discourse is a beautiful example of the Buddha's skill as teacher: not only does he talk about right speech, but he also demonstrates right speech in action.
- Bahuvedaniya Sutta (MN 59) -- The Many Kinds of Feeling {M i 396}. After resolving a disagreement about the classification of feelings, the Buddha enumerates the different kinds of pleasure and joy that beings can experience. [BB] [The text of this sutta is identical to that of SN XXXVI.19.]
- Ambalatthikarahulovada Sutta (MN 61) -- Advice to Rahula at Mango Stone {M i 414} [Thanissaro Bhikkhu, trans.]. The Buddha admonishes his son, the novice Rahula, on the dangers of lying and stresses the importance of constant reflection on one's motives. (This is one of the suttas selected by King Asoka (r. 270-232 BCE) to be studied and reflected upon frequently by all practicing Buddhists. See That the True Dhamma Might Last a Long Time: Readings Selected by King Asoka, by Thanissaro Bhikkhu.)
- Cula-Malunkyovada Sutta (MN 63) -- The Shorter Instructions to Malunkya {M i 426} [Thanissaro Bhikkhu, trans.]. Ven. Malunkyaputta threatens to disrobe unless the Buddha answers all his speculative metaphysical questions. Using the famous simile of a man shot by a poison arrow, the Buddha reminds him that some questions are simply not worth asking.
- Aggi-Vacchagotta Sutta (MN 72) -- To Vacchagotta on Fire {M i 483} [Thanissaro Bhikkhu, trans.]. The Buddha explains to a wanderer why he does not hold any speculative views. Using the simile of an extinguished fire he illustrates the destiny of the liberated being. [BB] [For more on the use of fire imagery in early Buddhist texts, see the book Mind Like Fire Unbound.]
- Magandiya Sutta (MN 75) -- To Magandiya {M i 501} (excerpt) [Thanissaro Bhikkhu, trans.]. In this passage, the Buddha teaches a member of a hedonist sect about the nature of true pleasure and true health. [TB]
- Ratthapala Sutta (MN 82) -- About Ratthapala {M ii 54} (excerpt) [Thanissaro Bhikkhu, trans.]. In this excerpt, Ratthapala recalls four observations about the world that prompted him, as a healthy and wealthy young man, to leave the household life and become a monk.
- Piyajatika Sutta (MN 87) -- From One Who Is Dear {M ii 106} [Thanissaro Bhikkhu, trans.]. King Pasenadi of Kosala figures prominently in many discourses as a devout follower of the Buddha. In this discourse we learn how -- thanks to Queen Mallika's astuteness -- the king first became favorably disposed toward the Buddha. [TB]
- Canki Sutta (MN 95) -- With Canki {M ii 164} (excerpt) [Thanissaro Bhikkhu, trans.]. A pompous brahman teenager questions the Buddha about safeguarding, awakening to, and attaining the truth. In the course of his answer, the Buddha describes the criteria for choosing a reliable teacher and how best to learn from such a person. [TB]
- Sunakkhatta Sutta (MN 105) -- To Sunakkhatta {M ii 252} [Thanissaro Bhikkhu, trans.]. The Buddha addresses the problem of meditators who overestimate their progress in meditation. The sutta ends with a warning: anyone who claims enlightenment as license for unrestrained behavior is like someone who fails to follow the doctor's orders after surgery, who knowingly drinks a cup of poison, or who deliberately extends a hand toward a deadly snake. [TB]
- Aneñja-sappaya Sutta (MN 106) -- Conducive to the Imperturbable {M ii 261} [Thanissaro Bhikkhu, trans.]. Advanced meditation instruction: how the fourth jhana and the formless attainments can be developed and used as a basis for the realization of Nibbana.
- Ganaka-Moggallana Sutta (MN 107) -- The Discourse to Ganaka-Moggallana {M iii 1} [I.B. Horner, trans.]. The Buddha sets forth the gradual training of the Buddhist monk and describes himself as a "shower of the way." [BB]
- Gopaka-Moggallana Sutta (MN 108) -- Moggallana the Guardsman {M iii 7} [Thanissaro Bhikkhu, trans.]. Ven. Ananda explains how the Sangha maintains its unity and internal discipline after the passing away of the Buddha. [BB] Interestingly, this sutta also shows that early Buddhist practice had no room for many practices that developed in later Buddhist traditions, such as appointed lineage holders, elected ecclesiastical heads, or the use of mental defilements as a basis for concentration practice. [TB]
- Maha-punnama Sutta (MN 109) -- The Great Full-moon Night Discourse {M iii 15} [Thanissaro Bhikkhu, trans.]. A thorough discussion of issues related to the five aggregates. Toward the end of the discussion, a monk thinks that he has found a loophole in the teaching. The way the Buddha handles this incident shows the proper use of the teachings on the aggregates: not as a metaphysical theory, but as a tool for questioning clinging and so gaining release.) [TB]
- Cula-punnama Sutta (MN 110) -- The Shorter Discourse on the Full-moon Night {M iii 20} [Thanissaro Bhikkhu, trans.]. How to recognize -- and become -- a person of integrity.
- Isigili Sutta (MN 116) -- The Discourse at Isigili {M iii 68} [Piyadassi Thera, trans.]. The Buddha enumerates the many paccekabuddhas who lived on Isigili mountain.
- Maha-cattarisaka Sutta (MN 117) -- The Great Forty {M iii 71} [Thanissaro Bhikkhu, trans.]. On the nature of noble right concentration, and its interdependence with all the factors of the noble eightfold path.
- Anapanasati Sutta (MN 118) -- Mindfulness of Breathing {M iii 78} [Thanissaro Bhikkhu, trans.]. One of the most important texts for beginning and veteran meditators alike, this sutta is the Buddha's "roadmap" to the entire course of meditation practice, using the vehicle of breath meditation. The simple practice of mindfulness of breathing leads the practitioner gradually through 16 successive phases of development, culminating in full Awakening.
- Kayagata-sati Sutta (MN 119) -- Mindfulness Immersed in the Body {M iii 88} [Thanissaro Bhikkhu, trans.]. This sutta serves as a companion to the Anapanasati Sutta [Thanissaro Bhikkhu, trans.]. and explains the importance of establishing a broad awareness of the body in meditation to develop jhana.
- Cula-suññata Sutta (MN 121) -- The Lesser Discourse on Emptiness {M iii 103} [Thanissaro Bhikkhu, trans.]. The Buddha instructs Ven. Ananda on the practice that leads to the "entry into emptiness," the doorway to liberation. [TB]
- Dantabhumi Sutta (MN 125) -- The Discourse on the "Tamed Stage" {M iii 128} [I.B. Horner, trans.]. By analogy with the taming of an elephant, the Buddha explains how he tames his disciples. [BB]
- Bhumija Sutta (MN 126) -- To Bhumija {M iii 138} [Thanissaro Bhikkhu, trans.]. Does the desire for Awakening get in the way of Awakening? According to this discourse, the question of desiring or not desiring is irrelevant as long as one develops the appropriate qualities that constitute the path to Awakening. The discourse is also very clear on the point that there are right and wrong paths of practice: as a geographer might say, not every river flows to the sea. [TB]
- Bhaddekaratta Sutta (MN 131) -- An Auspicious Day {M iii 187} [Thanissaro Bhikkhu, trans.]. The Buddha emphasizes the urgency of putting forth effort right now to develop insight. Now is all we have, "for -- who knows? -- tomorrow death may come."
- Cula-kammavibhanga Sutta (MN 135) -- The Shorter Exposition of Kamma {M iii 202} [Thanissaro Bhikkhu, trans. | Ñanamoli Thera, trans.]. Why do some people live a long life, but others die young? Why are some people born poor, but others born rich? The Buddha explains how kamma accounts for a person's fortune or misfortune.
- Maha-kammavibhanga Sutta (MN 136) -- The Greater Exposition of Kamma {M iii 207} [Ñanamoli Thera, trans.]. The Buddha reveals some of the subtle complexities in the workings of kamma. [BB]
- Uddesa-vibhanga Sutta (MN 138) -- An Analysis of the Statement {M iii 223} [Thanissaro Bhikkhu, trans.]. How to attend to outside objects without letting the mind become externally scattered, and how to focus in strong states of absorption without becoming internally positioned. It's not easy, but it can be done. [TB]
- Dhatu-vibhanga Sutta (MN 140) -- An Analysis of the Properties {M iii 238} [Thanissaro Bhikkhu, trans.]. A poignant story in which a wanderer, searching for the Buddha, actually meets the Buddha without realizing it. He recognizes his mistake only after the Buddha teaches him a profound discourse on four determinations and the six properties of experience. An excellent illustration of the Buddha's statement, "Whoever sees the Dhamma sees me." [TB]
- Saccavibhanga Sutta (MN 141) -- Discourse on The Analysis of the Truths {M iii 248} [Piyadassi Thera, trans.]. Ven. Sariputta gives a detailed explanation of the Four Noble Truths.
- Nadakovada Sutta (MN 146) -- Nandaka's Exhortation {M iii 270} [Thanissaro Bhikkhu, trans.]. Ven. Nandaka discusses impermanence with a large group of nuns, driving his point home with particularly vivid similes. It must have been an effective teaching: soon afterwards, these nuns all become enlightened.
- Chachakka Sutta (MN 148) -- The Six Sextets {M iii 280} [Thanissaro Bhikkhu, trans.]. How the contemplation of the six senses leads to an understanding of not-self and, ultimately, to Awakening.
- Maha-salayatanika Sutta (MN 149) -- The Great Six Sense-media Discourse {M iii 287} [Thanissaro Bhikkhu, trans.]. How a clear understanding of the six senses leads to the development of the Wings to Awakening and to final release.
- Indriya-bhavana Sutta (MN 152) -- The Development of the Faculties {M iii 298} [Thanissaro Bhikkhu, trans.]. What qualifies as full mastery of the senses?
Open Dharma Teachings and
Introductory Tibetan Buddhist Text Translations
Longchenpa's Great Chariot (with Lama Ugyen Shenpen): (revised 3/2002)
This commentary to The Great perfection, the Nature of Mind, the Easer of Weariness presents the stages of the Buddhist path from the viewpoint of the Tibetan Nyingma school. WordPerfect 5.1 zip file 672K RTF 593K zip file.
For MAC try MSWORD5,MAC zip file 525K ASCII text zipped 443K PDF 1358k
WP51 will work with later versions of word perfect and most other word processors. RTF works with all versions of MSWORD and others.
Mipham Rinpoche's The Sword of Knowledge with Khenchen Palden Sherab's commentary The Blazing Lights of the Sun and Moon
This text explains reasoning and theory of knowledge from a Tibetan Nyingma viewpoint. ASCII text 149K WordPerfect5.1 205K RTF 204K MSWORD5.0 MAC 181K PDF 458k
Mipham's commentary on the Shambhala sections of the Kalachakra Tantra
rtf (MS WORD etc. for PCs)
text
shambhala.htm
The History of Tilopa's Special Transmissions
rtf text Wordperfect6 word for MAC HTML PDF
The Buddhist Tradition
OUR Scriptural RESOURCES -
LINKS TO OTHER ON-LINE RESOURCES
From: Dharma Haven
Basic Instruction on Meditation Practice
Pema Chödrön - Sakyong Mipham - Thrangu Rinpoche Seven Points on Meditation -- Shamar Rinpoche Calm Abiding and Insight Meditation -- Shamarpa
Turning the Mind into an Ally Sakyong Mipham Rinpoche
Tonglen (Sending and Taking) Practice
Shamar Rinpoche - Pema Chödrön - Thrangu Rinpoche
!! Ashoka New Media Buddhist Learning Center !!
Mahayana Buddhist Texts and Commentaries
Glossary of Buddhist Terms
Dharma Dictionary - Digital Dictionary of Buddhism
Audio and Video of Dharma Masters
Introduction to the Major Traditions of Buddhism
!!! Shenpen Ösel !!!
Venerable Khenchen Thrangu Rinpoche
Dhagpo Kagyu Teachings
Teachings from Karma Kagyu Buddhist Network (in English, German and Polish)
Teachings from Karma Triyana Dharmachakra
Short Discourses from Various Sources
Mahayana Buddhism V
"Dive into this treasure-laden scripture dumpster"
1 - THE MIDDLE WAY IN OLD BUDDHISM
- Old sutras about the Emptiness, the Tetralemma, the Middle Way between existence an non-existence, non-duality, ...
- Abhidharma's interpretation of the old sutras -- Hinayana view
- Prajnaparamita's interpretation of the old sutras -- the Middle Way approach
- Vimalakirti Nirdesa Sutra
DIALECTICAL:
- Fundamental of the Middle Way (Mulamadhyamakakarikas) -- the best, but the hardest to follow -- all the rest is not 1% of this one --
- Refutation of Objections / Averting the Arguments (Vigrahavyavartani)
- Karikas & Vigrahavyavartani (verses only) (MS Word zipped 225k) / (pdf - 881k) ,
- Commentary on Nagarjuna’s The Refutation of Criticism -- selected verses, by Khenpo Tsultrim Gyamtso Rinpoche (Shenpen Osel Main Menu - htm) / (Zip)
- Seventy verses on Sunyata (Shunyatasaptati)
- Sixty verses of Arguments (Yuktisastika)
- Establishment of Convention - Six verses from a Lost Text (Vyavaharasiddhi)
- Pratityasamudpada Hrdayakarika
- Treatise called "The Finely Woven" (Vaidalyaprakarana / Vaidalyasutranama)
- See also: "Precious Garland of Advice for a King -- Le Précieux Rosaire" (Ratnavali) (see bellow)
- See also: "Essay on the Mind of Enlightenment -- Exposition of Bodhicitta - Commentaire sur l'Esprit d'Eveil" (Bodhicittavivarana) (see bellow)
ADVICE:
- Letter to a friend (Suhrllekha) -- attribution to Nagarjuna has been contested -- the most 'elementary' of Nagarjuna's writings
- La Lettre à un Ami du Supérieur Nagarjuna (MS Word zipped) (220k) / (pdf - 900k) , Une explication du Vénérable Geshé Ngawang Khyenrab, d'après des commentaires tibétains, Traduction de Georges Driessens assisté de Michel Zaregradsky
- Nagarjuna: A Good Friend By Dr. Peter Della Santina
- Precious Garland of Advice for a King -- Le Précieux Rosaire (Ratnavali)
- Precious Garland (MS Word zipped) (150k) / (pdf - 600k)
- "T. Vetter's analysis of its metrical characteristics and word frequency casts doubt upon it too."
- The Sceptre of Wisdom - L'Arbre de Sagesse (Prajnadanda)
- The Staff of Wisdom (Lugs kyi bstan-bcos shes-rab sdong-po) (MS Word zipped 60k) / (pdf - 175k)
- "Many works attributed to Nagarjuna are considered doubtful but are perhaps authentic with later amendments and interpolations. Akutobhaya and Prajnadanda belong to this category"
HYMS:
TANTRIC WORKS:
- Compendium des Sutras (Sutrasa-muccaya)
- "attribution of it to Nagarjuna by Santideva in his Bodhicaryavatara"
- Les Cinq Stades (Pancakrama)
- Exposition of Bodhicitta - Commentaire sur l'Esprit d'Eveil (Bodhicittavivarana)
- Paths and Grounds of Guhyasamaja Tantra according to Arya Nagarjuna - 21 states that make up the State of a Buddha
OTHER:
Interpretations and mis-interpretations by modern authors :
- Aryadeva (175-275) (Met Nagarjuna on pilgrimage and became his devotee; Nagarjuna's principal disciple at Nalanda -- His student was Rahulamitra who taught Nagamitra who taught Samgharaksita who passed these teachings to Buddhapalita and Bhaviviveka.)
- Buddhapalita (470-540) (He emphasized the use of Prasanga-Madhyamika or "necessary consequence," which would later attract Shantideva and is today propounded by the Gelug order)
- Buddhapalita's Commentary on (Nagarjuna's) 'Treatise on the Middle Way' (Buddhapalita-mula-madhyamaka-vrtti)
- Chandrakirti (600-700) (Studied under Buddhapalita's disciple Kamalabuddhi; defended the Prasangika; called the "ultimate" disciple of Nagarjuna himself)
- Commentary on Chandrakirti’s Entrance to the Middle Way (Madhyamakavatara), by Khenpo Tsultrim Gyamtso Rinpoche (splitted in two files:)
- Candrakirti's sevenfold reasoning - Meditation on the selflessness of persons (MS Word zipped) (550k) (pdf - 600k)
- Commentary on the 'Supplement to (Nagarjuna's) "Treatise on the Middle Way" (Madhyamakavatarabhasya)
- Clear Words,Commentary on (Nagarjuna's) "Treatise on the Middle Way" (Mulamadhyamakavataravrttiprasannapada)
- Another Kind of Self-Inquiry: Chandrakirti’s Sevenfold Reasoning on Selflessness
- Commentary on the "Four Hundred Syanzas on the Yogic Deeds of Bodhisattvas" of Aryadeva (bodhisattvayogacaryacatuhsatakatika)
- Commentary on (Nagarjuna's) 'Seventy Stanzas on Emptiness' (Shunyatasaptativrtti)
- Treatise on Five Skandha (Pancaskandhaprakarana)
- Commentary on (Nagarjuna's) ' Sixty Stanzas of Reasoning' (Yuktisastika-vritti)
- Four Hundred Commentary (Catuh-shataka-tika)
- Madhyamakaprajnavatara
- Trisarana-saprati
- Shantideva (685-763) (Nagarjuna's disciple, at Nalanda)
3 - TIBETAN MADHYAMIKA BUDDHISM
· Atisha (980-1052) (Lo Jong Tradition) (Arrived in Tibet in 1039. Founder of the Kadampa school; set up the outlines of Lamrim)
· Seven Points of Mind Training (Tonglen) - Atisha & al. (MS Word zipped) (700k) / (pdf - 1.9 Meg) Commentaries on The Seven Points of Mind Training; Seven Point Mind Training Prayer by Atisha; The Seven Points Thought Transformation (Lojong Dun Dunma) by Chekawa; The Eight Verses of Thought Transformation (lojong) by Geshe Langri Tangpa; Leveling out all Conceptions (Tonglen) by Serlingpa; The Peacock's Neutralizing of Poisons by Dharmarakshita; Using Illness To Train The Mind by 7th Dalai Lama;
· A Lamp for the Enlightenment Path (html) (Bodhi-Patha-Pradîpâ) - which is a succinct outline of the stages of the path (Tib.: lam rim)
· Essential wealth for the warrior like people who wish to be liberated (html)
· The Jewel Rosary of an Awakening Warrior - Bodhisattvamaniavali (html)
· Advice from Atisha (html)
· Other texts of the same author: "A Summary of the Means for Accomplishing the Mahâyâna Path" (Mahâyâna-Patha-Sâdhana-Varna-Samgraha) // "A Letter of Stainless Gems" (Vimala-Ratna-Lekhâ) // "A Guide to the Two Levels of Truth" (Satya-Dvaya-Avâtara) // Advice from Atisha's Heart // Praise of Arya Tara // Atisha 59 slogans for codifying conduct // Atisha's Pith Saying // The Wheel of Sharp Weapons, Dharmarakshita
· Bodhicitta
· Help in developing Aspiring Bodhicitta (html) (Zip - 1.2Meg) ,/ (pdf - 1.6 Meg) The Cultivation of Bodhicitta and Taking and Sending by Lama Tashi Namgyal (Shenpen Osel Main Menu - htm) / (Zip)
· Gon-chok-jik-may-wang-bo (1728-1791)
· Precious Garland of Tenets (presents the principal tenets of Indian schools both Buddhist and non-Buddhist – it details the presentations of cyclic existence and selflessness in the four schools, Vaibashika, Sautrantika, Chittamatra, and Madhyamika)
o Part I -- A commentary on Tsong Khapa's Three Principal Aspects of the path by the Fourth Panchen Lama (see bellow under Tsong Khapa)
o Part II-A -- about the non-buddhits schools of tenets (MS Word zipped) (600k) (pdf - 2.2 Meg)
o Part II-B -- about the Buddhits schools of tenets (MS Word zipped) (600k) (pdf - 1.5 Meg)
· His Holiness The 14th Dalai Lama (1935- )
· The Key to the Middle Way + The Buddhism of Tibet + The Song of the Four Mindfulnesses Causing the Rain of Achievements to Fall Instructions for Meditation on the View of Emptiness (MS Word zipped 100k) / (pdf - 400k)
· A Survey of the Paths of Tibetan Buddhism (html) (zip - 204k)
· An Interview with HHDL (html) (zip - 204k)
· Jam-yang-shay-ba (1648-1721)
· Great Exposition of Tenets - Chapter 12 - Prasangika - (MS Word zipped 1.5 Meg) / (pdf - 4 Meg) (+ Notes: MS Word zipped, PDF)
· Jang-gya (1717-1786)
· Presentation of Tenets - The Harmony of Emptiness and Dependent-Arising in the Middle Way Consequence School (MS Word zipped 700k) / (pdf - 2 Meg)
· Lamrim
· 21 Lumières du Noël de 1997 (un résumé du Lamrim)
· Longchenpa Rabjampa (1308-1363) (The most brilliant scholar of the Nyingmapa tradition; synthesized Dzogchen into a unified system)
· Longchenpa's Great Chariot (zip - 3.7 Meg)
· Thirty Pieces of Advice From the Heart, by Gyalwa Longchenpa (html) (zip - 240k)
· Trente conseils donnés du coeur, par Gyalwa Longchenpa (html) (zip - 240k)
· Seven Treasuries (mdzod-bdun), which are formulations of the Nyingma path, integrating the Sutrayana with the tantras of Dzogchen
· Mahamudra (most gouped into one 120k Zip file )
· The Main Road of the Triumphant Ones, The First Panchen Lama (htm) (Zip)
· Wishing Prayer for the Attainment of the Ultimate Mahamudra, Karmapa Rangjung Dorje (htm) (Zip)
· Teachings on Mahamudra, H.E.Dorzong Rinpoche (htm) (Zip)
· The Song of the Five-Fold Profound Path of Mahamudra (htm) (Zip)
· The Song of the Four Mindfulnesses, Causing the Rain of Achievements to Fall, Kaysang Gyatso, the Seventh Dalai Lama (htm) (Zip)
· Mahamudra Teachings, Ven. Kalu Rinpoche (htm) (Zip)
· The Mahamudra Lineage Prayer, Dorje Chang Thungma (htm) (Zip)
· Dzogchen (most gouped into one Zip file )
· The Three Incisive Precepts of Garab Dorje & The Extraordinary Teaching of Glorious Sovereign Wisdom: by Patrul Rinpoche (htm) (zip - 240k)
· The Cuckoo's Song of Total Presence (htm) (zip - 240k)
· Dzogchen Excerpts (htm) (zip - 240k)
· Thirty Pieces of Advice From the Heart, by Gyalwa Longchenpa (html) (zip - 240k)
· Trente conseils donnés du coeur, par Gyalwa Longchenpa (html) (zip - 240k)
· See also Mipham bellow
· Maitreya
· La Lignée Spirituelle des Trois Joyaux / Analysis of the Jewel Matrix , Supreme Tantra of the Universal Vehicle (Ratnagotravibhaga-mahayana-uttaratantra-shastra)
· An Ornament for Clear Realization (Abhisamayalamkara) // Analysis of the Jewel Matrix , Supreme Tantra of the Universal Vehicle (Ratnagotravibhaga-mahayana-uttaratantra-shastra) // Discrimination between Center and Extremes (Madhyantavibhaga) // Elucidation of the Intention Scripture (Samdhinirmocana Sutra) // Scripture Ornament (Mahayanasutralamkara)
· Chan
· The Sixth Patriarch Hui Neng's (638 - 713) Platform Sutra (html) (Zip 160k)
· Zen teachings of Master Lin-Chi (805-867) (html) (Zip 120k)
· Lin-chi and the True Man without Rank (html) (Zip 120k)
· Lin-Chi (html) (Zip 120k)
· Mipham Rinpoche (1846-1912) (Argued for a Madhyamika interpretation of the Nyingma teachings.)
· The Sword of Knowledge -- Sherab Raltri, with Khenchen Palden Sherab's commentary “The Blazing Lights of the Sun and Moon”
· Beacon of Certainty (Illuminating the View of Dzogchen, the Great Perfection) + A commentary by Khro shul 'Jam rdor Other small texts from Mipham and from other Dzogchen authors
- Sakya Pandita Kunga Gyaltshan (1182-1251)
- Elegant Sayings (Legs-bshad rin-po-che'i gter)
- "The Discrimination of The Three Vows" (sDom-gsum Rab-dbye)
- "The Treasury of Knowledge Concernin Ideal Cognition" (Tshad-ma Rig-pa'i gTer)
- Shenpen Osel Magazine
- Shenpen Osel Main Menu - htm (a ton of excellent commentaries + annotations) / (Zip 1.7Meg)
- Tsong Khapa (1357-1418) (Founder of the Geluk or Gaden order)
- Various Teachings & Praises (MS Word zipped) (500k) / (pdf - 1.5 Meg)
Three Principals of the Path, A Letter of Practical Advice on Sutra and Tantra, Prayer of the Virtuous Beginning Middle and End, The Mountain of Blessings, Praise for Relativity, The Ocean of Clouds of Praises of the Guru Manjughosha, Brahma's Diadem, Prayer for Rebirth in Sukhavati, Garland of Supremely Healing Nectars, Lord of Tushita's Hundred Gods, Reviewing the Stages of the Path in Guru Puja, Outline of Lamrim, Migtsema, etc.
- Tsong Khapa Four Texts on Realizing Emptiness (MS Word zipped) (400k) (pdf - 1.4 Meg)
(Gen Lamrimpa’s teaching based on Tsong Khapa’s “An elucidation of the meaning of the Middle Way”, Tsong Khapa’s Lines of Experience - the abbreviated points of the graded path, Tsong Khapa’s The middle length transcendent insight, Tsong Khapa’s The Refutation of an Identification of the Object of Negation That Is Too Narrow, Atisha's Lamp for the Enlightenment Path )
- Another commentary on Tsong Khapa's Three Principal Aspects of the path by the Fourth Panchen Lama (MS Word zipped) (450k) (pdf - 2.3 Meg)
- Essence of True Eloquence (MS Word zipped) (100k) (pdf - 0.4 Meg)
- Great Treatise on the Stages of Spiritual Practice (Lam-Rim-Chen-Mo) - based on Atisha's Lamp for the Path to Enlightenment
Learn about the life of the main source of inspiration for the archives, Tsenzhab Serkong Rinpoche.
Find answers to some of the basic questions about Buddhism and its relevance to daily life.
The spread of Buddhism in Asia and introductory history of the Tibetan traditions of Buddhism and Bon.
Read about the basic forms of Buddhism, the terms Hinayana and Mahayana, the four Tibetan Buddhist traditions and Bon.
What is the current situation of Buddhism and its appeal in the modern world? Read about Buddhism and science, and much more.
The Islamic-Buddhist dialogue - the ancient and modern interaction between these two spiritual traditions.
A comprehensive course, covering the Graded Path (Lamrim), Cleansing of Attitudes (Lojong), and Buddhist views on mind and reality.
How can contemporary Westerners approach tantra practice? This section guides through levels of understanding tantra.
Here you find the essentials for attending a Kalachakra initiation, an explanation of the Shambhala myth, and a selection of the major practice texts.
This section covers the theory, meditation, and history of dzogchen.
Details of the refuge, bodhisattva, and tantric vows.
A collection of meditation texts, including guru-yogas and pujas.
Explore the basic features of Tibet's unique calendar, astrology, and medical system.
Full versions of several published books and unpublished manuscripts by Dr. Berzin.
Bernie Dunham
MOUStech.NET, LLC
112 Acorn Drive
Dickson, TN 37055
bdunham@moustech.net
Website: http://www.moustech.net/
Weblog: http://www.moustech.info/
8:47:16 AM
|
|
Yahoo Retools Search Engine. Rolling out a souped-up search engine Monday, Yahoo makes a bid to supplant its business partner, Google, as the most popular place to find things on the Internet. The company says its search engine will be more useful and simpler to use than Google. [Wired News]
8:07:18 AM
|
|
Al Qaeda Website Refuses to Die. A website believed to be al Qaeda's primary online address has been shut down several times by ISPs. However, it continues to survive as an Internet parasite, secretly embedding itself inside other unsuspecting sites. By Michele Delio. [Wired News]
8:02:57 AM
|
|
© Copyright 2003 Bernie Dunham.
|
|
 |
 |
 |
 |
| April 2003 |
| Sun |
Mon |
Tue |
Wed |
Thu |
Fri |
Sat |
| |
|
1 |
2 |
3 |
4 |
5 |
| 6 |
7 |
8 |
9 |
10 |
11 |
12 |
| 13 |
14 |
15 |
16 |
17 |
18 |
19 |
| 20 |
21 |
22 |
23 |
24 |
25 |
26 |
| 27 |
28 |
29 |
30 |
|
|
|
| Mar May |
|
 |
 |
 |
 |
|